NLN Rabbit pAb

ArtNr	A13112-100ul
Hersteller	Abclonal
Menge	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Neuroscience Aging & Neurological Disorders Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	DGQYYGYLWSEVFSMDMFYSCFKKEGIMNPEVGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLMSRGLHAP
NCBI	NLN
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MEP,MOP,AGTBP,EP24.16,NLN
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	81kDa
Background	This gene encodes a member of the metallopeptidase M3 protein family that cleaves neurotensin at the Pro10-Tyr11 bond, leading to the formation of neurotensin(1-10) and neurotensin(11-13). The encoded protein is likely involved in the termination of the neurotensinergic signal in the central nervous system and in the gastrointestinal tract.
Manufacturer - Cross Reactivity	Human, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 630-704 of human NLN (NP_065777.1).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	81kDa
Route	Recombinant protein
Manufacturer - Research Area	Cell Biology Developmental Biology, Ubiquitin, Endocrine Metabolism, Mitochondrial metabolism, Mitochondrial markers.
Antigen Seq	DGQYYGYLWSEVFSMDMFYSCFKKEGIMNPEVGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLMSRGLHAP
Manufacturer - Gene ID (Human)	57486
Expected Protein Size	81kDa
Gene Symbol	NLN

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A13112-100ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern