PLA2G6 Rabbit pAb

ArtNr	A9492-20ul
Hersteller	Abclonal
Menge	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Metabolism Cholesterol & Lipid Metabolism Antibodies Western Blot Enzymes Fatty Acid Catabolism Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	EGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
NCBI	PLA2G6
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	GVI,PLA2,INAD1,NBIA2,iPLA2,NBIA2A,NBIA2B,PARK14,PNPLA9,CaI-PLA2,IPLA2-VIA,iPLA2beta,PLA2G6
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	90kDa
Background	The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date.
Manufacturer - Cross Reactivity	Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 151-250 of human PLA2G6 (NP_003551.2).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	90kDa
Route	Recombinant protein
Manufacturer - Research Area	Signal Transduction.
Antigen Seq	EGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
Manufacturer - Gene ID (Human)	8398
Expected Protein Size	90kDa
Gene Symbol	PLA2G6

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A9492-20ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ul

lieferbar

Lieferung vsl. bis 02.10.2025