« Zurück
Startseite /
Recombinant Human Oncostatin-M/OSM Protein

Recombinant Human Oncostatin-M/OSM Protein

ArtNr	RP00054-5ug
Hersteller	Abclonal
Menge	5 ug
Quantity options	100 ug 10 ug 20 ug 50 ug 5 ug
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Obesity
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	Oncostatin-M/OSM
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	OSM,oncostatin-M
Similar products	OSM, MGC20461, oncostatin-M, oncostatin M
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.01 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	22.15 kDa
Description	Recombinant Human Oncostatin-M/OSM Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala26-Arg221) of human Oncostatin-M/OSM (Accession #NP_065391.1).
Background	This protein is a member of the leukemia inhibitory factor/oncostatin-M (LIF/OSM) family. The preproprotein is proteolytically processed to generate the mature protein. This protein is a secreted cytokine and growth regulator that inhibits the proliferation of a number of tumor cell lines. This protein also regulates the production of other cytokines, including interleukin 6, granulocyte-colony stimulating factor and granulocyte-macrophage colony stimulating factor in endothelial cells.
Immunogen	Ala26-Arg221
Route	No tag
Manufacturer - Research Area	Cytokines & Cytokine receptors
Revised name	MGC20461, oncostatin M, oncostatin-M, OSM
Antigen Seq	AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
Bioactivity	Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is typically 0. 8-3. 2 ng/mL, corresponding to a specific activity of 3. 12×10⁵-1. 25×10⁶units/mg.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 150mM NaCl, 5% glycerol, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	22.15 kDa
Gene Symbol	Oncostatin-M/OSM

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00054-5ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern