Vergleich

Recombinant Human TNFRSF6/FAS/CD95 Protein Europäischer Partner

ArtNr RP00139-200ug
Hersteller Abclonal
Menge 200 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 90% by SDS-PAGE.
NCBI FAS/APO-1/CD95
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias ALPS1A,APO-1,APT1,CD95,FAS1,FASTM,TNFRSF6,FAS,ALPS1A,APO-1,APT1,CD95,FAS1,FASTM,TNFRSF6,Fas cell surface death receptor
Similar products TNFRSF6, APT1, FAS1, CD95, ALPS1A, APO-1, FASTM
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
43.43 kDa
Description
Recombinant Human TNFRSF6/FAS/CD95 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln26-Asn173) of human FAS/CD95/APO-1/TNFRSF6 (Accession #NP_000034.1) fused with an Fc, 6×His tag at the C-terminus.
Background
The protein is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Gln26-Asn173
Route
C-hFc&His
Manufacturer - Research Area
Bio-Markers & CD Antigens, TNF family
Revised name
ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
Antigen Seq
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized recombinant Human Fas Ligand at 2 μg/mL (100 μL/well) can bind recombinant Human FAS. The EC50 of Human FAS is 6. 23 ng/mL.|2. Measured by its ability to inhibit Fas Ligand-induced apoptosis of Jurkat Human acute T cell leukemia cells. The ED50 for this effect is typically 16. 5-66 ng/mL in the presence of 5 ng/mL Recombinant Human Fas Ligand.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
43.43 kDa
Gene Symbol
FAS/APO-1/CD95

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen