Recombinant Human IL-17A/CTLA-8 Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

IL17, also known as IL17a and CTLA8, is a is a 15-20 kDa glycosylated cytokine which belongs to the IL-17 family. The IL-17 family of cytokines includes six members, IL-17/IL-17A, IL-17B, IL-17C, IL-17D, IL-17E/IL-25, and IL-17F, which are produced by multiple cell types. IL17A promotes protective mucosal and epidermal inflammation in response to microbial infection .It induces chemokine production, neutrophil influx, and the production of antibacterial peptides .IL17A additionally enhances the production of inflammatory mediators by rheumatoid synovial fibroblasts and contributes to TNF alpha induced shock . In contrast, it can protect against the progression of colitis by limiting chronic inflammation . IL17A encourages the formation of autoreactive germinal centers and exacerbates the onset and progression of experimental models of autoimmunity .

Ile20-Ala155

< 0.1 EU/μg of the protein by LAL method.

IVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.

IL-17A/CTLA-8