Vergleich

Recombinant Human TGF-beta receptor type-2/TGFR-2 Protein Europäischer Partner

ArtNr RP00239-20ug
Hersteller Abclonal
Menge 20 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD
NCBI TGFR-2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias AAT3,FAA3,LDS1B,LDS2,LDS2B,MFS2,RIIC,TAAD2,TGFR-2,TGFbeta-RII,TGF beta Receptor II,TGFBR2,AAT3,FAA3,LDS1B,LDS2,LDS2B,MFS2,RIIC,TAAD2,TGFR-2,TGFbeta-RII,TGF-beta receptor type-2
Similar products TGFR-2, FAA3, AAT3, LDS1B, LDS2B, MFS2, RIIC, TAAD2, TGFbeta-RII, LDS2
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
42.30 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human TGF-beta receptor type-2/TGFR-2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Thr23-Asp159) of human TGFBR2 (Accession #NP_003233.4) fused with an Fc, 6×His tag at the C-terminus.
Background
Most cell types express three sizes of receptors for TGF-beta. These are designated Type I (53 kDa), Type II (70-85 kDa), and Type III (250-350 kDa). The Type III receptor, a proteoglycan that exists in membrane-bound and soluble forms, binds TGF-beta 1, TGF-beta 2, and TGF-beta 3 but does not appear to be involved in signal transduction. The Type II receptor is a membrane-bound serine/threonine kinase that binds TGF-beta 1 and TGF-beta 3 with high affinity and TGF-beta 2 with a much lower affinity. The Type I receptor is also a membrane-bound serine/threonine kinase that apparently requires the presence of the Type II receptor to bind TGF-beta. Current evidence suggests that signal transduction requires the cytoplasmic domains of both the Type I and Type II receptors.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Thr23-Asp159
Route
C-hFc&His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized recombinant human TGFB1 at 2 μg/mL (100 μL/well) can bind recombinant human TGFBR2 with a linear range of 1-5 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
42.30 kDa
Gene Symbol
TGFR-2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen