Vergleich

Recombinant Human Growth hormone receptor/GHR Protein Europäischer Partner

ArtNr RP00251-500ug
Hersteller Abclonal
Menge 500 ug
Quantity options 1000 ug 100 ug 200 ug 20 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
NCBI Growth hormone receptor/GHR
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias GHR,GHBP,GHIP
Similar products GHBP, GHIP
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.01 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
54.46 kDa
Description
Recombinant Human Growth hormone receptor/GHR Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala 27 - Tyr 264 ) of human Growth Hormone Receptor (GHR) (Accession #NP_000154.1) fused with an Fc, 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ala27-Tyr264
Route
C-hFc&His
Manufacturer - Research Area
Biosimilar Drug Targets
Revised name
GHBP, GHIP
Antigen Seq
AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human GH at 2 μg/mL (100 μL/well) can bind Human GHR with a linear range of 0. 1-8. 58 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
54.46 kDa
Gene Symbol
Growth hormone receptor/GHR

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen