Vergleich

Recombinant Human IL-6RA/CD126 Protein Europäischer Partner

ArtNr RP00269-50ug
Hersteller Abclonal
Menge 50 ug
Quantity options 100 ug 10 ug 20 ug 50 ug 5 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 92% by SDS-PAGE.
Sequence LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQ
NCBI IL-6RA/CD126
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IL6R,CD126,IL-6R-1,IL-6RA,IL6Q,IL6RA,IL6RQ,gp80
Similar products IL-6R, CD126, IL-6R-1, IL6RA, gp80, IL-6RA, IL6Q, IL6RQ
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
38.71 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human IL-6RA/CD126 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Asp358) of human IL-6 R alpha (Accession #NP_000556.1) fused with a 6×His tag at the C-terminus.
Background
The soluble form of recombinant human IL6R consists of 357 amino acids with a molecular weight of 40 kDa. It migrates with an apparent molecular mass of 60-65 kDa due to glycosylation in SDS-PAGE under reducing conditions. Interleukin 6 receptor (IL-6R) also known as CD126 (Cluster of Differentiation 126) is a potent pleiotropic cytokine that regulates cell growth and differentiation of various tissues, and is known particularly for its role in the immune response and acute phase reactions. The low concentration of a soluble form of IL-6 receptor (sIL-6R) acts as an agonist of IL-6 activity. In the IL-6R/CD126/IL6R system, both a membrane-bound IL-6R and a sIL-6R protein are able to mediate IL-6 signals into the cells through the interaction of gp13. The resulting IL-6/sIL-6R protein complex is also capable of binding to gp13 and inducing intracellular signalling. Through this so-called 'trans-signalling' mechanism, IL-6 is able to stimulate cells that lack an endogenous mIL-6R. Dysregulated production of IL6 and IL6R are implicated in the pathogenesis of several inflammatory diseases and malignancies, and it has been reported that a humanized anti-IL6R monoclonal antibody is a promising agent applicable to the therapeutic approach for IL6 driven diseases.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Leu20-Asp358
Route
C-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Bio-Markers & CD Antigens, Interleukin, Biosimilar Drug Targets
Antigen Seq
LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human IL6R at 1 μg/mL (100 μL/well) can bind Human IL-6 with a linear range of 2-15 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
38.71 kDa
Gene Symbol
IL-6RA/CD126

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen