Vergleich

Recombinant Human TNFRSF10B/DR5/TRAIL-R2/CD262 Protein Europäischer Partner

ArtNr RP00282-20ug
Hersteller Abclonal
Menge 20 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 90% by SDS-PAGE.
Sequence ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
NCBI TNFRSF10B/DR5/TRAIL-R2/CD262
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD262,DR5,KILLER,KILLER/DR5,TRAIL-R2,TRAILR2,TRICK2,TRICK2A,TRICK2B,TRICKB,ZTNFR9,TNFRSF10B
Similar products Human, CD262 Protein, DR5 Protein, KILLER Protein, KILLER/DR5 Protein, TRAIL-R2 Protein, TRAILR2 Protein, TRICK2 Protein, TRICK2A Protein, TRICK2B Protein, TRICKB Protein, ZTNFR9 Protein
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
15.13 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human TNFRSF10B/DR5/TRAIL-R2/CD262 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ile 56 - Glu 182) of human DR5 (Accession #NP_003833.3) fused with a 6×His tag at the C-terminus.
Background
This protein is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ile56-Glu182
Route
C-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Bio-Markers & CD Antigens, TNF family, Biosimilar Drug Targets
Antigen Seq
ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human TRAIL at 2 μg/mL (100 μL/well) can bind Recombinant Human DR5 with a linear range of 14-56 ng/mL.|2. Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 0. 38-1. 5 pg/mL in the presence of 20 ng/mL Recombinant Human TRAIL/TNFSF10. |3. Measured by its binding ability in a functional ELISA.Immobilized Human TRAIL / TNFSF10 Protein at 2μg/mL (100 μL/well) can bind Human CD262 Protein with a linear range of 0. 5-14. 1 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
15.13 kDa
Gene Symbol
TNFRSF10B/DR5/TRAIL-R2/CD262

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen