Vergleich

Recombinant Human Trk-C/NTRK3 Protein Europäischer Partner

ArtNr RP00288-100ug
Hersteller Abclonal
Menge 100 ug
Quantity options 100 ug 200 ug 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 97% by SDS-PAGE.
Sequence CPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIA
NCBI Trk-C/NTRK3
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias NTRK3,GP145-TrkC,TRKC,gp145(trkC)
Similar products GP145-TrkC, TRKC, gp145(trkC)
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
71.41 kDa
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human Trk-C/NTRK3 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Cys32-Asp428) of human TrkC/NTRK3 (Accession #NP_001012338.1) fused with an Fc, 6×His tag at the C-terminus.
Background
NT-3 growth factor receptor also known as neurotrophic tyrosine kinase receptor type 3 or TrkC tyrosine kinase or Trk-C receptor, is a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in TrkC encoding gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Cys32-Asp428
Route
C-hFc&His
Endotoxin
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Growth Factor
Antigen Seq
CPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISEGCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPITVTHKPEED
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human NTF3 at 2 μg/mL (100 μL/well) can bind Recombinant human TrkC with a linear range of 22-90 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
71.41 kDa
Gene Symbol
Trk-C/NTRK3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen