Recombinant Human NKG2D ligand 2/ULBP2 Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

ULBP2 Protein, Human, Recombinant (His Tag) consists of 203 amino acids with a molecular weight of 23.2 kDa. The apparent molecular mass of recombinant human ULBP2 is about 33 kDa in SDS-PAGE under reducing conditions because of glycosylation.NKG2D ligand 2 is cell membrane protein belonging to theMHC class I family.The gene for ULBP-2 resides in a cluster of ten related genes, six of which encode potentially functional glycoproteins. ULBPs are known to bind to human NKG2D, an activating receptor expressed on NK cells, NKT cells, gamma δ T cells, and CD8+ alpha beta T cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway.ULBP2 / N2DL-2 is not expressed in normal tissues, but in various types of cancer cell lines and the fetus and has been implicated in tumor surveillance.

Gly26-Ser217

< 0.1 EU/μg of the protein by LAL method.

GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.

NKG2D ligand 2/ULBP2