Vergleich

Recombinant Human S100-B Protein Europäischer Partner

ArtNr RP00699-500ug
Hersteller Abclonal
Menge 500 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
Sequence MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
NCBI S100-B
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias NEF,S100,S100-B,S100beta,S100B,S100 beta
Similar products S100b, Protein S100-B, S-100 protein beta chain, S-100 protein subunit beta, S100 beta, S100 calcium binding protein B, S100 calcium-bindingprotein B
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
38.35 kDa
Manufacturer - Additional Information
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human S100-B Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu92) of human S100 Calcium Binding Protein B/S100B (Accession #P04271) fused with an initial Met at the N-terminus and a 6×His tag at the N-terminus.
Background
S100-B, is an acidic protein with a molecular weight of 21 kDa belonging to the S100 family. S100-B containstwo EF-hand-type calcium-binding motifs separated by a hinge region with a hydrophobic cleft. S100-B playsan important role in neurodevelopment, differentiation, and brain construction. S100-B has neuroprotectiveeffects, but at high concentrations S100-B is neurotoxic. Extracellular concentration of S100-B increasesfollowing brain damage, which easily penetrates into cerebrospinal fluid in brain damage and then into theblood. S100-B is expressed and produced by astrocytes in vertebrate brains and in the CNS, and the astrocytesare the major cells producing S100-B protein in gray matter, as well as oligodendrocytes are the predominantS100-B in protein producing cells in white matter. The major advantage of using S100-B is that elevations inserum or CSF levels provide a sensitive measure for determining CNS injury at the molecular level before grosschanges develop, enabling timely delivery of crucial medical intervention before irreversible damage occurs. Inaddition, S100-B, which is also present in human melanocytes, is a reliable marker for melanoma malignancyboth in bioptic tissue and in serum.
Manufacturer - Cross Reactivity
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ser2-Glu92
Route
N-hFc&Avi
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Other Recombinant Protein
Antigen Seq
SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of 20mM PBS, 150mM NaCl, pH7.4.Contact us for customized product form or formulation.
Expected Protein Size
38.35 kDa
Gene Symbol
S100-B

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen