« Zurück
Startseite /
Recombinant Human Jagged1/JAG1/CD339 Protein

Recombinant Human Jagged1/JAG1/CD339 Protein

ArtNr	RP00877-500ug
Hersteller	Abclonal
Menge	500 ug
Quantity options	1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Kategorie	Oncology By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	WCGPRPCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNR
NCBI	Jagged1/JAG1/CD339
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	JAG1,AGS,AGS1,AHD,AWS,CD339,HJ1,JAGL1,jagged 1
Similar products	JAGL1, HJ1, Jagged-1, Protein jagged-1 I, JAG1 and CD339
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	44.74 kDa
Manufacturer - Additional Information	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human Jagged1/JAG1/CD339 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Trp896-Arg1065) of human Jagged-1/JAG1 (Accession #P78504) fused with an Fc tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Trp896-Arg1065
Route	C-hFc
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Bio-Markers & CD Antigens
Antigen Seq	WCGPRPCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDIRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNR
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Expected Protein Size	44.74 kDa
Gene Symbol	Jagged1/JAG1/CD339

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00877-500ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern