« Zurück
Startseite /
Recombinant Human ALK-1/ACVRL1 Protein

Recombinant Human ALK-1/ACVRL1 Protein

ArtNr	RP00978-5ug
Hersteller	Abclonal
Menge	5 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	ALK-1/ACVRL1
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ACVRL1,ACVRLK1,ALK-1,ALK1,HHT,HHT2,ORW2,SKR3,TSR-I,ALK-1,ALK1,HHT,HHT2,ORW2,SKR3,TSR-I
Similar products	ACVRLK1, ALK1, HHT2, ALK-1, HHT, ORW2, SKR3, TSR-I
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	Please contact us for more information.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	11.55 kDa
Description	Recombinant Human ALK-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp22-Gln118) of human ALK-1 (Accession #NP_000011.2) fused with a 6×His tag at the C-terminus.
Background	This protein is a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases.
Immunogen	Asp22-Gln118
Route	C-His
Manufacturer - Research Area	Cytokines & Cytokine receptors, Biosimilar Drug Targets
Revised name	ACVRLK1, ALK-1, ALK1, HHT, HHT2, ORW2, SKR3, TSR-I
Antigen Seq	DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQ
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human ALK-1 at 4 μg/mL (100 μL/well) can bind Human ACVR2B with a linear range of 0. 08-2. 4 μg/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	11.55 kDa
Gene Symbol	ALK-1/ACVRL1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00978-5ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern