Vergleich

Recombinant Human B7-H3/CD276 Protein Europäischer Partner

ArtNr RP01020-5ug
Hersteller Abclonal
Menge 5 ug
Quantity options 100 ug 10 ug 20 ug 50 ug 5 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
NCBI B7-H3/CD276
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CD276,4Ig-B7-H3,B7-H3,B7H3,B7RP-2,CD276 antigen,4Ig-B7-H3,B7-H3,B7H3,B7RP-2
Similar products B7H3, 4Ig-B7-H3, B7-H3, B7RP-2
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
24.15 kDa
Description
Recombinant Human B7-H3/CD276 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Pro245) of human B7-H3 (Accession #NP_079516) fused with a 6×His tag at the C-terminus.
Immunogen
Leu29-Pro245
Route
C-His
Manufacturer - Research Area
Immune Checkpoint, Bio-Markers & CD Antigens, Biosimilar Drug Targets
Revised name
4Ig-B7-H3, B7-H3, B7H3, B7RP-2
Antigen Seq
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human B7-H3 at 2 μg/mL (100 μL/well) can bind Anti-Human B7-H3 Antibody with a linear range of 1-4 ng/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
24.15 kDa
Gene Symbol
B7-H3/CD276

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen