« Zurück
Startseite /
Recombinant Human VEGF-A/VEGF165 Protein

Recombinant Human VEGF-A/VEGF165 Protein

ArtNr	RP01150-5ug
Hersteller	Abclonal
Menge	5 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Kategorie	Oncology By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines Adenocarcinoma By Organ Bladder Cancer
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
NCBI	VEGF-A/VEGF165
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	VEGFA,MVCD1,VEGF,VPF,vascular endothelial growth factor A,MVCD1,VEGF,VPF,L VEGFA,VEGF A
Similar products	VEGFA, VPF, MVCD1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	20.01 kDa
Description	Recombinant Human VEGF-A/VEGF165 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Arg191) of human VEGF165 (Accession #NP_001165097.1) fused with a 6×His tag at the N-terminus.
Immunogen	Ala27-Arg191
Route	N-His
Manufacturer - Research Area	Growth Factor, Cell Culture related, Biosimilar Drug Targets
Revised name	MVCD1, VEGFA, VPF
Antigen Seq	APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Bioactivity	1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human VEGF165 at 1 μg/mL (100 μL/well) can bind Recombinant Human VEGFR2 with a linear range of 8-20 ng/mL.\|2. Measured by its binding ability in a functional ELISA. Immobilized Human VEGF165 at 2 μg/mL (100 μL/well) can bind Human KDR with a linear range of 0. 2-11. 6 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	20.01 kDa
Gene Symbol	VEGF-A/VEGF165

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01150-5ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern