Vergleich

Recombinant Human VEGF-A/VEGF121 Protein Europäischer Partner

ArtNr RP01162-5ug
Hersteller Abclonal
Menge 5 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
NCBI VEGF-A/VEGF121
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias VEGFA,MVCD1,VEGF,VPF,vascular endothelial growth factor A,MVCD1,VEGF,VPF,L VEGFA,VEGF A
Similar products VEGF, VPF, MVCD1
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
14.91 kDa
Description
Recombinant Human VEGF-A/VEGF121 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Arg147) of human VEGF121 (Accession #NP_001165099.1) fused with a 6×His tag at the N-terminus.
Background
This protein is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This protein is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Elevated levels of this protein are found in patients with POEMS syndrome, also known as Crow-Fukase syndrome.
Immunogen
Ala27-Arg147
Route
N-His
Manufacturer - Research Area
Growth Factor, Cell Culture related, Biosimilar Drug Targets
Revised name
MVCD1, VEGF, VPF
Antigen Seq
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human VEGF121 at 1 μg/mL (100 μL/well) can bind Recombinant Human VEGFR2 with a linear range of 4-10 ng/mL.|2. Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 for this effect is 0. 09-0. 36 ng/mL.|3. Recombinant Human VEGFA(40 ng/mL) and bFGF(50 ng/mL, Cat. RP01162) induce mesoderm cells to differentiate into hematopoietic stem and progenitor cells. After 4 days induction, pebbly-like CD43+ hematopoietic stem and progenitor cells appeared in the hematogenic endothelium.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
14.91 kDa
Gene Symbol
VEGF-A/VEGF121

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen