« Zurück
Startseite /
Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein

Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein

ArtNr	RP01164-200ug
Hersteller	Abclonal
Menge	200 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug
Kategorie	Oncology Neuroscience Metabolism Diabetes Glucose Homeostasis Neural Adhesion Molecules By Cell Type Blastoma Carcinoma Hematology Lymphoma Myeloma Melanoma Sarcoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion Obesity Cell Stainings ECM By Organ Breast Cancer
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Rat (Rattus norvegicus)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	Irisin/FNDC5
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FRCP2,irisin,FNDC5
Similar products	FNDC5, FRCP2, Irisin, fibronectin type III domain containing 5, fibronectin type III domain-containing protein 5, FRCP2Fibronectin type III repeat-containing protein 2
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	13.43 kDa
Description	Recombinant Human/Mouse/Rat Irisin/FNDC5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp32-Glu143) of Human/Mouse/Rat Irisin (Accession #NP_715637.2) fused with a 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Asp32-Glu143
Route	C-His
Manufacturer - Research Area	Other Recombinant Protein
Revised name	fibronectin type III domain containing 5, fibronectin type III domain-containing protein 5, FNDC5, FRCP2, FRCP2Fibronectin type III repeat-containing protein 2, Irisin
Antigen Seq	DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE
Bioactivity	Measured by its ability to induce p38 MAPK activation in 3T3 L1 mouse embryonic fibroblast adipose-like cells. 0. 1 μg/mL of Recombinant Human Irisin can effectively induce p38 MAPK activation.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	13.43 kDa
Gene Symbol	Irisin/FNDC5

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01164-200ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern