« Zurück
Startseite /
Recombinant Human Renin/REN Protein

Recombinant Human Renin/REN Protein

ArtNr	RP01175-100ug
Hersteller	Abclonal
Menge	100 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins Cardiovascular Research Heart Failure Myocardial Infarction Hypertension
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 97% by SDS-PAGE.
Sequence	LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGS
NCBI	Renin/REN
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HNFJ2,REN,renin,Renin
Similar products	REN, Renin, FLJ10761, HNFJ2, angiotensinogenase
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Other Recombinant Protein
Shipping Temperature	ice pack
Storage Conditions	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human Renin/REN Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu24-Arg406) of human Renin (Accession #NP_000528.1.) fused with a 8xHis tag at the C-terminus.
Immunogen	Leu24-Arg406
Route	C-His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Other Recombinant Protein
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human REN Protein at 0. 5 μg/mL (100 μL/well) can bind Renin Rabbit pAb with a linear range of 1. 9-302. 7 ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01175-100ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 21.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern