« Zurück
Startseite /
Recombinant Human IL-2RG/CD132 Protein

Recombinant Human IL-2RG/CD132 Protein

ArtNr	RP01205-200ug
Hersteller	Abclonal
Menge	200 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug
Kategorie	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	IL-2RG/CD132
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL2RG,CD132,CIDX,IL-2RG,IMD4,P64,SCIDX,SCIDX1
Similar products	CD132, IMD4, SCIDX, SCIDX1, P64, CIDX, IL-2RG
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	28.22 kDa
Description	Recombinant Human IL-2RG/CD132 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Asn254) of human CD132 (Accession #NP_000197.1.) fused with a 6×His tag at the C-terminus.
Background	The gamma chain of the high affinity functional human IL-2 receptor complex belongs to the hematopoietin receptor family. The common gamma chain (γc) (or CD132), also known as interleukin-2 receptor subunit gamma or IL2RG, is a member of the type I cytokine receptor family expressed on most lymphocyte (white blood cell) populations, and its gene is found on the X-chromosome of mammals. IL2RG is a 369 amino acid residue protein consisting of a 22 residue signal sequence, a 232 residue extracellular domain, a 29 residue transmembrane domain and an 86 residue cytoplasmic domain. IL2RG is a cytokine receptor sub-unit that is common to the receptor complexes for at least six different interleukin receptors: IL-2, IL-4, IL-7, IL-9, IL-15 and interleukin-21 receptor. It has been proposed that IL2RG be designated the common gamma chain ( gammac). The site of molecular defects in X-linked SCID (severe combined immunodeficiency) has now been mapped to the IL-2 R gamma gene.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Leu23-Asn254
Route	C-His
Manufacturer - Research Area	Bio-Markers & CD Antigens, Interleukin
Revised name	CD132, CIDX, IL-2RG, IMD4, P64, SCIDX, SCIDX1
Antigen Seq	LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	28.22 kDa
Gene Symbol	IL-2RG/CD132

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01205-200ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern