« Zurück
Startseite /
Recombinant Mouse FGF-1/aFGF Protein

Recombinant Mouse FGF-1/aFGF Protein

ArtNr	RP00487-50ug
Hersteller	Abclonal
Menge	50 ug
Quantity options	1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Kategorie	Oncology Neuroscience Metabolism Regulation of Appetite Neural Signaling Neural Adhesion Molecules By Cell Type Carcinoma Glioma Hematology Myeloma Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines By Organ Bladder Cancer
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mouse
Purity	> 95% by SDS-PAGE.
NCBI	FGF-1/aFGF
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fibroblast Growth Factor 1,FGF-1,Acidic Fibroblast Growth Factor,aFGF,Heparin-BindingGrowth Factor 1,HBGF-1,Fgf1,Fgf-1,Fgfa
Similar products	Acidic Fibroblast Growth Factor, Fgf1, aFGF, Fibroblast Growth Factor 1, FGF-1, Fgfa, Fgf-1, HBGF-1, Heparin-BindingGrowth Factor 1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	15.79 kDa
Description	Recombinant Mouse FGF-1/aFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Phe16-Asp155) of mouse FGF1/FGFa/FGF acidic (Accession #P61148).
Background	FGF acidic is a 17 kDa nonglycosylated member of the FGF family of mitogenic peptides. FGF acidic, which isproduced by multiple cell types, stimulates the proliferation of all cells of mesodermal origin and many cells ofneuroectodermal, ectodermal, and endodermal origin. It plays a number of roles in development, regeneration, and angiogenesis. FGF-acidic is a non-glycosylated heparin binding growth factor that isexpressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes andendothelial cells. FGF-acidic has the ability to signal through all the FGF receptors.
Manufacturer - Cross Reactivity	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Phe16-Asp155
Route	No tag
Manufacturer - Research Area	Growth Factor
Revised name	Fibroblast Growth Factor 1, FGF-1, Acidic Fibroblast Growth Factor, aFGF, Heparin-BindingGrowth Factor 1, HBGF-1, Fgf1, Fgf-1, Fgfa
Antigen Seq	FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, pH7.5, 50 mM Na₂SO₄, 0.5 mM DTT, 1 mM EDTA. Contact us for customized product form or formulation.
Expected Protein Size	15.79 kDa
Gene Symbol	FGF-1/aFGF

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00487-50ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern