« Zurück
Startseite /
Recombinant Human IL-23A&Mouse IL-12B Protein

Recombinant Human IL-23A&Mouse IL-12B Protein

ArtNr	RP00632-500ug
Hersteller	Abclonal
Menge	500 ug
Quantity options	1000 ug 100 ug 10 ug 500 ug 50 ug
Kategorie	Oncology Neuroscience Neural Signaling By Cell Type Blastoma Sarcoma Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Mouse
Purity	> 95% by SDS-PAGE;> 95% by HPLC
NCBI	IL-23 alpha&Mouse IL-12 beta
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IL23 alpha,IL12 beta,IL23 alpha&IL12 beta ,IL12 β,IL23 alpha&IL12 β
Similar products	SHH, HHG-1, Sonic Hedgehog Protein
Lieferbar
Manufacturer - Applications	< 1 EU/μg of the protein by LAL method
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	21.7 kDa (Human IL-23 alpha), 35.8 kDa (Mouse IL-12 beta).
Description	Recombinant Human IL-23A&Mouse IL-12B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg20-Pro189(Human IL-23 alpha) & Met23-Ser335(Mouse IL-12 beta)) of Human IL-23 alpha&Mouse IL-12 beta (Accession #Q9NPF7(Human IL-23 alpha)&P43432-1(Mouse IL-12 beta)) fused with a C-His&Avi tag at the C-terminus.
Background	Interleukin (IL)-12 and IL-23 belong to the IL-12 type family and are composite cytokines, consisting of the common β subunit p40 and the specific cytokine α subunit p35 and p19, respectively. IL-12 signals via the IL-12Rβ1·IL-12Rβ2 receptor complex, and IL-23 uses also IL-12Rβ1 but engages IL-23R as second receptor.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Arg20-Pro189(Human IL-23 alpha) & Met23-Ser335(Mouse IL-12 beta)
Route	C-His&Avi
Manufacturer - Research Area	Biosimilar Drug Targets
Revised name	Sonic Hedgehog Protein, SHH, HHG-1, SHH
Antigen Seq	RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Protein Formulation	Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size	21.7 kDa (Human IL-23 alpha), 35.8 kDa (Mouse IL-12 beta).
Gene Symbol	IL-23 alpha&Mouse IL-12 beta

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00632-500ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern