Vergleich

Recombinant Mouse TNFSF11/RANKL/CD254 Protein Europäischer Partner

ArtNr RP00745-10ug
Hersteller Abclonal
Menge 10 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Host Mouse
Purity > 95% by SDS-PAGE.
Sequence QRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
NCBI TNFSF11/RANKL/CD254
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tumor necrosis factor ligand superfamily member 11,Tnfsf11,Osteoclast differentiationfactor,ODF,Osteoprotegerin ligand,OPGL,Receptor activator of nuclear factor kappa-Bligand,RANKL,TNF-related activation-induced cytokine,TRANCE,CD254,TNFSF11
Similar products CD254, RANKL, Tnfsf11, ODF, OPGL, TRANCE, TNF-related activation-induced cytokine, Tumor necrosis factor ligand superfamily member 11, Osteoprotegerin ligand, Osteoclast differentiationfactor, Receptor activator of nuclear factor kappa-Bligand
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
TNF family
Shipping Temperature
ice pack
Storage Conditions
Store the lyophilized protein at -20°C to -80°C for 12 months.|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Manufacturer - Additional Information
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Mouse TNFSF11/RANK L/TRANCE Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg156-Asp316) of mouse TNFSF11/RANK L/TRANCE (Accession #O35235).
Background
Mouse tumor necrosis factor ligand superfamily member 11(Tnfsf11) is a member of the tumor necrosis factor(TNF) cytokine family. Tnfsf11 is widely expressed in cells including T cells and T cell rich organs, such asthymus and lymph nodes. This cytokine can bind to TNFRSF11B/OPG andTNFRSF11A/RANK. Tnfsf11 is involvedin a number of fundamental biological processes such as acting as regulator of interactions between T-cells anddendritic cells, the regulation of the T-cell-dependent immune response and enhancing bone-resorption inhumoral hypercalcemia of malignancy. It augments the ability of dendritic cells to stimulate naive T-cellproliferation.
Immunogen
Gln137-Asp316
Route
No tag
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
TNF family
Bioactivity
Measured by its ability to induce osteoclast differentiation of RAW 264. 7 mouse monocyte/macrophage cells. The ED50 for this effect is 2. 30-9. 22 ng/mL, corresponding to a specific activity of 1. 08x105~4. 35x105 units/mg.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen