« Zurück
Startseite /
Recombinant Mouse TNF-alpha Protein

Recombinant Mouse TNF-alpha Protein

ArtNr	RP01071-20ug
Hersteller	Abclonal
Menge	20 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Kategorie	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Molecular Targets for Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mouse
Purity	> 87% by SDS-PAGE.
Sequence	LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
NCBI	TNF-alpha
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DIF,Tnfa,TNF-a,TNFSF2,Tnlg1f,Tnfsf1a,TNFalpha,TNF-alpha,TNF
Similar products	TNF-alpha, TNFA, TNFalpha, TNFSF2, DIF, cachectin
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	18.10 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Mouse TNF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu80-Leu235) of mouse TNF-alpha (Accession #NP_038721.1) fused with a 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Leu80-Leu235
Route	C-His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	TNF family, Cell Culture related
Antigen Seq	LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Bioactivity	1. Recombinant Mouse TNF-α protein was measured by NF-κB reporter assay in HEK293 cells. The ED₅₀ for this effect is 40-200 pg/mL.\|2. Measured by its binding ability in a functional ELISA. Immobilized Mouse TNF-α at 2 μg/mL (100 μL/well) can bind Mouse TNFRSF1B with a linear range of 0. 02-0. 77 ng/mL.\|3. Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED₅₀ for this effect is 0. 025-0. 1 pg/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	18.10 kDa
Gene Symbol	TNF-alpha

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01071-20ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern