« Zurück
Startseite /
Recombinant Mouse IFN-beta Protein

Recombinant Mouse IFN-beta Protein

ArtNr	RP01076-5ug
Hersteller	Abclonal
Menge	5 ug
Quantity options	100 ug 10 ug 20 ug 50 ug 5 ug
Kategorie	Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mouse
Purity	> 92% by SDS-PAGE.
NCBI	IFN-beta
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fibroblast interferon,IFBIFNB,IFF,IFNB1,IFNbeta,IFN-beta,interferon beta,,IFNB
Similar products	IFN-beta, IFNB1, IFF, interferon beta, Fibroblast interferon, IFBIFNB, IFNbeta
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	46.52 kDa
Description	Recombinant Mouse IFN-beta Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Asn182) of mouse Interferon beta (Accession #NP_034640.1) fused with an Fc, 6×His tag at the C-terminus.
Immunogen	Ile22-Asn182
Route	C-hFc&His
Manufacturer - Research Area	Cytokines & Cytokine receptors
Revised name	Fibroblast interferon, IFBIFNB, IFF, IFNB1, IFNbeta, IFN-beta, interferon beta,
Antigen Seq	INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
Bioactivity	Recombinant Mouse IFN-beta enhances STAT1 autophosphorylation in Bone-marrow-derived macrophage (BMDM). 5-500 ng/mL of Recombinant Mouse IFN-beta can enhance STAT1 autophosphorylation.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	46.52 kDa
Gene Symbol	IFN-beta

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01076-5ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 5 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern