« Zurück
Startseite /
Recombinant Rat Lipocalin-2/NGAL/LCN2 Protein

Recombinant Rat Lipocalin-2/NGAL/LCN2 Protein

ArtNr	RP01225-50ug
Hersteller	Abclonal
Menge	50 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 500 ug 50 ug
Kategorie	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Rat (Rattus norvegicus)
Host	Rat
Purity	> 95% by SDS-PAGE.
Sequence	QDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAANAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN
NCBI	Lipocalin-2/NGAL/LCN2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	NGAL,LCN2,Lipocalin-2,24p3,MSFI,LCN2
Similar products	LCN2, NGAL, Lipocalin-2, 24p3, MSFI
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	21.34 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Rat Lipocalin-2/NGAL/LCN2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln21-Asn198) of rat Lipocalin-2/NGAL (Accession #NP_570097.1.) fused with a 6×His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Gln21-Asn198
Route	C-His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Other Recombinant Protein
Antigen Seq	QDSTQNLIPAPPLISVPLQPGFWTERFQGRWFVVGLAANAVQKERQSRFTMYSTIYELQEDNSYNVTSILVRGQGCRYWIRTFVPSSRPGQFTLGNIHSYPQIQSYDVQVADTDYDQFAMVFFQKTSENKQYFKVTLYGRTKGLSDELKERFVSFAKSLGLKDNNIVFSVPTDQCIDN
Bioactivity	Measured by its ability to bind Iron(III) dihydroxybenzoic acid [Fe(DHBA)3]. The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in Lipocalin2 . It binds >51330 μM of Fe(DHBA)3.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 20mM Tris, 500mM NaCl, pH 7.0Contact us for customized product form or formulation.
Expected Protein Size	21.34 kDa
Gene Symbol	Lipocalin-2/NGAL/LCN2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01225-50ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern