Vergleich

Active Recombinant human Growth Hormone Europäischer Partner

ArtNr RF0011-50
Hersteller Agrenvec
Menge 50ug
Kategorie
Typ Proteins Recombinant
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Somatotropin, Growth hormone 1, Pituitary growth hormone
Lieferbar
Molecular Weight:
Recombinant human GH is a protein composed of 22.9 kDa, 205 amino residues.
Molecular Formula:
C1025H1570N280O306S7
p.I:
5.98
Ext. Coeff. Abs (280nm) 0.1% (=1g/l) =
0.77
UniProtKB:
P01241
Endotoxin level:
Endotoxin Level : < 0.04 EU / ug protein (LAL method)
Source:
Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
Description:
GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation, an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
Sequence:
HHHHHHFPTIPLSRPFDNAMLRAHRLHQLAFDTYQ EFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNR EETQQKSNLELLRISLLLIQSWLEPVQFLRSVFAN SLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPR TGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKD MDKVETFLRIVQCRSVEGSCGFAG
Formulation:
Recombinant human GH is lyophilized from 10mM Phosphate Potasium buffer pH 7, 6 and 0.05M NaCl.
Purity
Purity >97% by SDS-PAGE gel
Applications:
Functional studies, Cell culture, Western Blot, Dermocosmetics (rh GH stimulates fibroblast cell proliferation, kerotinocytes migration (HaCaT cells) and induces whitening activity ).
Bioassay 1 - Result assay 1:
1. Effect of recombinant human Growth Hormone on Nb2-11 cells proliferation. - The biological activity of human Growth Hormone is measured by cell proliferation using Nb2-11 cells. ED50 <= 0.04-0.1 ng/mL
Bioassay 2 - Result assay 2:
2. Effect of rH GH on kerotinocytes migration (HaCaT cells). - Cell migration after 24h of treatment with different concentrations of rh GH, scale bar 100 px, A: Untreated cells, B: Positive control Growth factor cocktail 10% , C: 1 ng/ml rH GH, D: 5ng/ml rH GH.
Bioassay 3 - Result assay 3:
3. Effect of rh GH on Human fibroblast cell proliferation. - Cell viability was assessed by MTT assay and showed very significant (*) (p<0.0001) stimulation of fibroblasts proliferation at 1 ng/ml and 5ng/ml of rH GH
Bioassay 4 - Result assay 4:
4. Whitening activity of rh GH on in vitro reconstructed tissues of pigmented skin. After treatment tissues were evaluated by histology analysis (Haematoxylin – Eosin staining), cell viability and melanin quantification. - Melanin quantification in RHPE treated tissues. A: Untreated cells, B: Positive control (2% Ascorbic acid) Cell viability 93% , rh GH (5 ng/ml) Cell viability 96%.
References:
- Chen, H.C. et al. J. Biol. Chem. 245, 3402-3406 (1970) - Goffin, V. et al., Endocrine Rev. 17, 385-410 (1996) - Le Roith, D. et al. Endocrine Rev. 22, 53-74 (2001) - Roskam, W. et al. Nucleic Acids res. 7, 305-320 (1979) - Welniak, L.A. et al. J. Leukoc. Biol. 71, 381-387 (2002)
RESCONSTITUTION RECOMENDATION QC SHEET
Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/ul. Optimal concentration should be determined for specific application and cell lines.
Storage and Stability:
This lyophilized preparation is stable at 2-8C C for short term, long storage it should be kept at -20C. Reconstituted protein should be stored in working aliquots at –20C. Repeated freezing and thawing is not recommended.
Shipping
Room temperature
Available sizes (ug) :
1 ug, 10 ug, 50ug, 100ug, 1000ug of active protein

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen