Comparison

Active Recombinant human Growth Hormone European Partner

Item no. RF0011-50
Manufacturer Agrenvec
Amount 50ug
Category
Type Proteins Recombinant
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Somatotropin, Growth hormone 1, Pituitary growth hormone
Available
Molecular Weight:
Recombinant human GH is a protein composed of 22.9 kDa, 205 amino residues.
Molecular Formula:
C1025H1570N280O306S7
p.I:
5.98
Ext. Coeff. Abs (280nm) 0.1% (=1g/l) =
0.77
UniProtKB:
P01241
Endotoxin level:
Endotoxin Level : < 0.04 EU / ug protein (LAL method)
Source:
Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
Description:
GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation, an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
Sequence:
HHHHHHFPTIPLSRPFDNAMLRAHRLHQLAFDTYQ EFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNR EETQQKSNLELLRISLLLIQSWLEPVQFLRSVFAN SLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPR TGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKD MDKVETFLRIVQCRSVEGSCGFAG
Formulation:
Recombinant human GH is lyophilized from 10mM Phosphate Potasium buffer pH 7, 6 and 0.05M NaCl.
Purity
Purity >97% by SDS-PAGE gel
Applications:
Functional studies, Cell culture, Western Blot, Dermocosmetics (rh GH stimulates fibroblast cell proliferation, kerotinocytes migration (HaCaT cells) and induces whitening activity ).
Bioassay 1 - Result assay 1:
1. Effect of recombinant human Growth Hormone on Nb2-11 cells proliferation. - The biological activity of human Growth Hormone is measured by cell proliferation using Nb2-11 cells. ED50 <= 0.04-0.1 ng/mL
Bioassay 2 - Result assay 2:
2. Effect of rH GH on kerotinocytes migration (HaCaT cells). - Cell migration after 24h of treatment with different concentrations of rh GH, scale bar 100 px, A: Untreated cells, B: Positive control Growth factor cocktail 10% , C: 1 ng/ml rH GH, D: 5ng/ml rH GH.
Bioassay 3 - Result assay 3:
3. Effect of rh GH on Human fibroblast cell proliferation. - Cell viability was assessed by MTT assay and showed very significant (*) (p<0.0001) stimulation of fibroblasts proliferation at 1 ng/ml and 5ng/ml of rH GH
Bioassay 4 - Result assay 4:
4. Whitening activity of rh GH on in vitro reconstructed tissues of pigmented skin. After treatment tissues were evaluated by histology analysis (Haematoxylin – Eosin staining), cell viability and melanin quantification. - Melanin quantification in RHPE treated tissues. A: Untreated cells, B: Positive control (2% Ascorbic acid) Cell viability 93% , rh GH (5 ng/ml) Cell viability 96%.
References:
- Chen, H.C. et al. J. Biol. Chem. 245, 3402-3406 (1970) - Goffin, V. et al., Endocrine Rev. 17, 385-410 (1996) - Le Roith, D. et al. Endocrine Rev. 22, 53-74 (2001) - Roskam, W. et al. Nucleic Acids res. 7, 305-320 (1979) - Welniak, L.A. et al. J. Leukoc. Biol. 71, 381-387 (2002)
RESCONSTITUTION RECOMENDATION QC SHEET
Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/ul. Optimal concentration should be determined for specific application and cell lines.
Storage and Stability:
This lyophilized preparation is stable at 2-8C C for short term, long storage it should be kept at -20C. Reconstituted protein should be stored in working aliquots at –20C. Repeated freezing and thawing is not recommended.
Shipping
Room temperature
Available sizes (ug) :
1 ug, 10 ug, 50ug, 100ug, 1000ug of active protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close