Vergleich

alpha-Bungarotoxin-ATTO Fluor-550 Europäischer Partner

ArtNr ALO-B-100-AY-0.1mg
Hersteller Alomone
Menge 0.1 mg
Quantity options 0.1 mg 5 x 0.1 mg
Kategorie
Typ Proteins Native
Format Lyophilized
Applikationen FC, IF
Specific against other
Konjugat/Tag Rhodamine
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Electrophysiology, Live cell imaging, Immunofluorescence, Fluorescence staining, Direct flow cytometry
Manufacturer - Category
Proteins
Manufacturer - Targets
α7, α1/β1/γ/δ nAChR and GABA(A) receptor subtypes
Manufacturer - Conjugate / Tag
ATTO-550. Maximum absorption 554 nm; maximum fluorescence 576 nm. The fluorescence is excited most efficiently in the 540-565 nm range. This label is related to the dye Rhodamine 6G and can be used with filters used to detect Rhodamine. The extent of labeling is 1-3 molecules of dye per molecule α-Bungarotoxin.
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light.
Storage Conditions
Storage as Solution: Avoid exposure to light. Store the reconstituted solution for the shortest time possible at -20°C. We do not recommend storing the product in working solution for longer than one day. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light. - Storage after Reconstitution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.
Molecular Weight
~ 9134 Da
Manufacturer - Format
Lyophilized
Short description
A Fluorescent Conjugate for Sensitive Detection of Neuromuscular Junctions, GABA(A) Receptors, nAChRs, and α-Bungarotoxin Binding Sites.
Description
Long neurotoxin 1, α-Bgtx, α-BuTX - A Fluorescent Conjugate for Sensitive Detection of Neuromuscular Junctions, GABA(A) Receptors, nAChRs, and α-Bungarotoxin Binding Sites
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
PH
7, 4
UNSPSC
12352202
Origin
Modified natural protein isolated from Bungarus multicinctus (Many-banded krait).
Modifications
Disulfide bonds between: Cys3-Cys23, Cys16-Cys44, Cys29-Cys33, Cys48-Cys and Cys60-Cys65 ATTO Fluor-550
Effective Concentration
0.1 – 0.5 µM
Activity
α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs), thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission. Selective for α7 receptors (IC50 value of 1.6 nM) and α3/β4 receptors (IC50 value of >3 μM)1, 2. The toxin also blocks GABA(A) receptor subtypes3.
Solubility
The product is lyophilized in 0.5 ml conical vial.Centrifuge all products BEFORE adding solvent (10, 000 x g for 5 minutes). The preparation of fresh solutions in working buffers before use is recommended. Soluble in pure water to high-micromolar concentrations (50 µM-1 mM). For long-term storage in solution, it is recommended to prepare a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between x100-1000 of the final working concentration. Divide the solution into single-use aliquots and store at -20°C. Before use, thaw the relevant vial(s) intended for use and dilute in the desired working buffer. Avoid multiple freeze-thaw cycles to maintain toxin activity
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
α-Bungarotoxin isoform A31 is a 74 amino acid peptidyl toxin isolated from the venom of the banded krait snake, Bungarus multicinctus1. α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs) with an IC50 of 3.5 x 10-10 M, thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission2. The toxin is selective for α7 receptors (IC50 value of 1.6 nM) and α3/β4 receptors (IC50 value of >3 µM)3, 4. α-Bungarotoxin also binds to and blocks a subset of GABAA receptors (GABAARs) that contain the GABAAR β3 subunit. In particular, α-Bungarotoxin blocks GABAARs that contain interfaces between adjacent β3 subunits5.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen