Vergleich

µ-TRTX-Df1a Europäischer Partner

ArtNr ALO-STD-050-0.5mg
Hersteller Alomone
Menge 0.5 mg
Quantity options 0.1 mg 0.5 mg 50 ug
Kategorie
Typ Molecules
Format Lyophilized
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence ECRWFLGGCSGGQTCCEHLVCHRKHQWCVWDWSF – NH2
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Electrophysiology
Manufacturer - Category
Toxins
Manufacturer - Targets
NaV channels and T-type Ca2+ channels
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the toxin in working solutions for longer than a few days. Avoid multiple freeze- thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
4078.6 Da
Manufacturer - Format
Lyophilized
Short description
A Blocker of Voltage-Gated Na+ and T-Type Ca2+ Channels
Description
Mu-TRTX- Df1a, Mu-theraphotoxin-Df1a, Df1a
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
PH
7, 4
UNSPSC
12352202
Origin
Davus fasciatus (Costa Rican tiger rump) (Cyclosternum fasciatus)
Modifications
Disulfide bonds location- Cys2-Cys16, Cys9-Cys21, Cys15-Cys28 Phe34 - C-terminal amidation
Effective Concentration
20 nM – 0.5 µM
Activity
Df1a exhibits a rank order of potency for hNaV channels as follows: 1.7 > 1.2 > 1.3 > 1.6 > 1.1 > 1.4 > 1.5, and for hCaV3 channels, the order is 3.1 > 3.3 > 3.2. Also, Df1a demonstrates a dual modulatory effect by simultaneously inhibiting peak current and slowing fast inactivation of NaV1.1, NaV1.3, and NaV1.5 subtypes1.
Solubility
Soluble in water. For long-term storage in solution, we recommend to prepare a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration X100-1000 of final working solution. Divide the solution into small aliquots and store at -20°C. Upon use, thaw the relevant vial intended for use and dilute in your desired working buffer. The preparation of fresh solutions in working buffers before use is recommended. Repeat freeze-thawing might result in loss of activity. Centrifuge all product preparations before use (10000 x g, 5 min)
Sterile endotoxin free
No
Bioassay tested
Yes
Scientific Background
µ-TRTX-Df1a (Df1a) is a 34-amino acid peptide toxin originally isolated from the venom of the tarantula Davus fasciatus. This toxin has been identified as a potent blocker of voltage-gated sodium (NaV) and calcium (CaV)3 channels1. Df1a exhibits a rank order of potency for hNaV channels as follows: 1.7 > 1.2 > 1.3 > 1.6 > 1.1 > 1.4 > 1.5, and for hCaV3 channels, the order is 3.1 > 3.3 > 3.2. Additionally, Df1a demonstrates a dual modulatory effect by simultaneously inhibiting peak current and slowing fast inactivation of NaV1.1, NaV1.3, and NaV1.5 subtypes. It also alters the voltage dependence of activation and inactivation for most NaV subtypes1. Df1a belongs to the Family 2 of NaV-targeting spider toxins (NaSpTx), characterized by an inhibitor cystine knot (ICK) motif and highly conserved N- and C-terminal regions1. ICK peptides possess a disulfide-rich structural framework that creates a "knot, " imparting exceptional structural, thermal, and proteolytic stability. CaV3 are T-type, low voltage-gated calcium channels. Their electrophysiological properties include low voltage thresholds for activation and inactivation, rapid inactivation, and rebound bursting. These properties are responsible for the CaV3-mediated fine-tuned regulation of neuronal excitability in both the central nervous system (CNS) and peripheral nervous system (PNS)2. Nav channels are involved in a wide array of physiological processes. There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1–NaV1.9. They are transmembrane proteins responsible for propagating action potentials in excitable cells, most notably nerves and muscle. These channels are considered to be important therapeutic targets for a wide variety of pathophysiological conditions such as chronic pain, cardiac arrhythmia, and epilepsy3, 4. Df1a acted as an analgesic in vivo, alleviating the spontaneous pain behaviors triggered by the NaV activator OD11.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 08.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen