Vergleich

Omega-Grammotoxin SIA Europäischer Partner

ArtNr ALO-STG-450-0.1mg
Hersteller Alomone
CAS-Nr. 152617-90-8
Menge 0.1 mg
Quantity options 0.1 mg 0.5 mg 1 mg 50 ug 5 mg
Kategorie
Typ Molecules
Format Lyophilized
Specific against other
Purity ≥98% (HPLC)
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV-NH<sub>2</sub>
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Electrophysiology
Manufacturer - Category
Proteins
Manufacturer - Targets
P-type and N-type Ca2+ channels
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Molecular Weight
4109.8 Da
Manufacturer - Format
Lyophilized
Short description
A Blocker of CaV2.1 (P-type) and CaV2.2 (N-type) Channels
Description
Omega-theraphotoxin-Gr1a, ω-TRTX-Gr1a, ω-GrTx SIA, ω-GsTx SIA, Omega-GTX SIA - A Blocker of CaV2.1 (P-type) and CaV2.2 (N-type) Channels
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Specificity

A Blocker of CaV2.1 (P-type) and CaV2.2 (N-type) Channels

PH
7, 4
UNSPSC
12352202
Origin
Grammostola rosea (Chilean rose tarantula) (Grammostola spatulata)
Modifications
Disulfide bonds between Cys2-Cys16, Cys9-Cys21, and Cys15-Cys30
V36 - C-terminal amidation
Effective Concentration
50 - 500 nM
Activity
ω-Grammotoxin SIA is a potent inhibitor of both P- and N-type Ca2+ channels1.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
ω-Grammotoxin SIA is a 36 amino acid peptidyl toxin originally isolated from the venom of the South American Tarantula spider, Grammostola spatulata. ω-Grammotoxin SIA potently inhibits both CaV2.1 (P-type) and CaV2.2 (N-type) Ca2+ channels by altering the voltage-dependence of channel gating. ω-Grammotoxin SIA caused a concentration-dependent and virtually complete inhibition of K+-evoked influx of 45Ca2+ into either rat or chick brain synaptosomes.1 ω-Grammotoxin SIA at 1 µM, a maximally effective concentration, blocked 52% of IBa in cultured rat hippocampal neurons.2 A concentration of >50 nM toxin completely inhibited Ca2+ currents in Purkinje neurons (predominantly, P-type channels) and in sympathetic neurons (predominantly, N-type channels).3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.1 mg
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 08.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen