« Zurück
Startseite /
Calcitonin, salmon - 5 mg

Calcitonin, salmon - 5 mg

ArtNr	AS-20678
Hersteller	AnaSpec
Menge	5 mg
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Peptides By Organ Thyroid Cancer
Typ	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: 1-7)
Citations	Andreotti, G. et al. J Biol Chem 281, 24193 (2006), doi: 10.1074/jbc.M603528200
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Calcitonin
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3432.1
Description	A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.
Product Group	LB1A3Z
Research Area	Hormones; Cell Signaling / Lyophilized
Sequence One-Letter Code	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
GTIN	5400535054076
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-20678-safety-datasheet.pdf