« Back
Home /
Calcitonin, salmon - 5 mg

Calcitonin, salmon - 5 mg

Item no.	AS-20678
Manufacturer	AnaSpec
Amount	5 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Peptides By Organ Thyroid Cancer
Type	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: 1-7)
Citations	Andreotti, G. et al. J Biol Chem 281, 24193 (2006), doi: 10.1074/jbc.M603528200
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Calcitonin
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3432.1
Description	A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.
Product Group	LB1A3Z
Research Area	Hormones; Cell Signaling / Lyophilized
Sequence One-Letter Code	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
GTIN	5400535054076
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-20678-safety-datasheet.pdf