« Zurück
Startseite /
Glucagon-Like Peptide 1, GLP-1 (7-37) human, mouse, rat, bovine, guinea pig - 0.5 mg

Glucagon-Like Peptide 1, GLP-1 (7-37) human, mouse, rat, bovine, guinea pig - 0.5 mg

ArtNr	AS-20761
Hersteller	AnaSpec
Menge	0.5 mg
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
Citations	Brubaker, P. and D. Drucker, Receptors Channels 8, 179 (2002)Leonova, J. et al. Am J Physiol Cell Physiol 281, C1495 (2001)Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987)Rönnbäck, L. and E. Hansson, J Neuroinflamm 1, 22 (2004)Rothstein, JD. et al. Neuron 16, 675 (1996)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Glucagon-Like Peptide 1 (GLP-1)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3355.9
Description	GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated.
Product Group	LB1A1Z
Research Area	Diabetes/Metabolism; Hormones; Cell Signaling / Lyophilized
Sequence One-Letter Code	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
GTIN	5400535053888
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 06.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern