« Back
Home /
Glucagon-Like Peptide 1, GLP-1 (7-37) human, mouse, rat, bovine, guinea pig - 0.5 mg

Glucagon-Like Peptide 1, GLP-1 (7-37) human, mouse, rat, bovine, guinea pig - 0.5 mg

Item no.	AS-20761
Manufacturer	AnaSpec
Amount	0.5 mg
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
Citations	Brubaker, P. and D. Drucker, Receptors Channels 8, 179 (2002)Leonova, J. et al. Am J Physiol Cell Physiol 281, C1495 (2001)Drucker, D. et al. Proc Natl Acad Sci USA 84, 3434 (1987)Rönnbäck, L. and E. Hansson, J Neuroinflamm 1, 22 (2004)Rothstein, JD. et al. Neuron 16, 675 (1996)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Glucagon-Like Peptide 1 (GLP-1)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3355.9
Description	GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated.
Product Group	LB1A1Z
Research Area	Diabetes/Metabolism; Hormones; Cell Signaling / Lyophilized
Sequence One-Letter Code	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
GTIN	5400535053888
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 9/25/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer