« Zurück
Startseite /
Amylin (8-37), rat, mouse - 1 mg

Amylin (8-37), rat, mouse - 1 mg

ArtNr	AS-21749
Hersteller	AnaSpec
Menge	1 mg
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides By Organ Breast Cancer
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Citations	Ref: Deems, RO. et al. Biochem. Biophys. Res. Commun. 181, 116 (1991); Hettiarachchi, M. et al. Am. J. Physiol. Endocrinol. Metab. 273, E859 (1997).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3200.8
Description	This is a truncated peptide of native rat amylin. In-vivo and in-vitro studies suggest that it acts as a specific amylin antagonist. In isolated soleus muscle, it blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin-resistant rats. It also elicits a significant alteration of in-vivo lipid metabolism.
Product Group	LB1A1Z
Research Area	Diabetes/Metabolism; Hormones; Cell Signaling / Lyophilized
Sequence One-Letter Code	ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
GTIN	5400535049539
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-21749-safety-datasheet.pdf