« Back
Home /
Amylin (8-37), rat, mouse

Amylin (8-37), rat, mouse

Item no.	AS-21749
Manufacturer	AnaSpec
CASRN	138398-61-5
Amount	1 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides By Organ Breast Cancer
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Citations	Ref: Deems, RO. et al. Biochem. Biophys. Res. Commun. 181, 116 (1991); Hettiarachchi, M. et al. Am. J. Physiol. Endocrinol. Metab. 273, E859 (1997).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Amylin, Islet Amyloid Polypeptide (IAPP)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3200.8
Manufacturer - Research Area	Diabetes/Metabolism; Hormones; Cell Signaling / Insulin/Amylin; Pancreas; GPCR
Description	This is a truncated peptide of native rat amylin. In-vivo and in-vitro studies suggest that it acts as a specific amylin antagonist. In isolated soleus muscle, it blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin-resistant rats. It also elicits a significant alteration of in-vivo lipid metabolism.
Sequence One-Letter Code	ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535049539

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-21749-safety-datasheet.pdf