« Zurück
Startseite /
Glucagon (1-37), Oxyntomodulin, porcine - 1 mg

Glucagon (1-37), Oxyntomodulin, porcine - 1 mg

ArtNr	AS-22455
Hersteller	AnaSpec
Menge	1 mg
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH
Citations	Pocai A. Mol Metab 3, 241 (2014), doi:10.1016/j.molmet.2013.12.001
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Glucagon
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4422.1
Description	Following nutrient ingestion, both GLP-1, and Oxyntomodulin (OXM) are processed from proglucagon and secreted from the gut endocine L-cells. Oxyntomodulin (OXM) a 37-amino acid peptide hormone causes weight loss in humans and rodents. It activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). It contains the same sequence as Glucagon (1-29), but with an additional KRNKNNIA C-terminal sequence.
Product Group	LB1A1Z
Research Area	Diabetes/Metabolism; Hormones; Cell Signaling / Lyophilized
Sequence One-Letter Code	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
GTIN	5400535046828
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-22455-safety-datasheet.pdf