« Back
Home /
Glucagon (1-37), Oxyntomodulin, porcine

Glucagon (1-37), Oxyntomodulin, porcine

Item no.	AS-22455
Manufacturer	AnaSpec
CASRN	159002-68-3
Amount	1 mg
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH
Citations	Pocai A. Mol Metab 3, 241 (2014), doi:10.1016/j.molmet.2013.12.001
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Glucagon
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4422.1
Manufacturer - Research Area	Diabetes/Metabolism; Hormones; Cell Signaling / Glucagon; Pancreas; GPCR
Description	Following nutrient ingestion, both GLP-1, and Oxyntomodulin (OXM) are processed from proglucagon and secreted from the gut endocine L-cells. Oxyntomodulin (OXM), a 37-amino acid peptide hormone, causes weight loss in humans and rodents. It activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). It contains the same sequence as Glucagon (1-9), but with an additional KRNKNNIA C-terminal sequence.
Sequence One-Letter Code	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535046828

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-22455-safety-datasheet.pdf