« Zurück
Startseite /
VIP, human, porcine, rat

VIP, human, porcine, rat

ArtNr	AS-22872
Hersteller	AnaSpec
CAS-Nr.	40077-57-4
Menge	0.5 mg
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
Citations	Paul, S. et al. J Biol Chem 276, 28314 (2001)Paul, S. et al. J Biol Chem 266,16128 (1991)Delgado, M. et al. J. Leukocyte Biol 73, 155 (2003)Yamamoto, K. et al. Diabetes 52, 1155 (2003)Ganea, D. Cell Mol Biol (Noisy-le-grand) 49, 127 (2003)Poso, D. and M. Delgado, FASEB J 18, 1325 (2004)Romano, D. et al. J Biol Chem 278, 51386 (2003).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Vasoactive Intestinal Peptide (VIP)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3326
Manufacturer - Research Area	Cardiovascular Research; Hormones; Cell Signaling / Vasoconstriction/Vasodilation; Gastrointestinal Tract; GPCR
Description	The 28-amino acid neuropeptide VIP (Vasoactive Intestinal Peptide) is a neurotransmitter and a neuromodulator. VIP is broadly distributed in the peripheral and central nervous systems. It has an amino acid sequence identity of 68% with pituitary adenylate cyclase-activating polypeptide (PACAP). VIP and PACAP inhibit TNF-a, IL-1ß, IL-6, and NO production by lipopolysaccharide (LPS)-activated microglia. Both regulate the production of proinflammatory factors at a transcriptional level by inhibiting p65 nuclear translocation and nuclear factor-kB-DNA binding. As well, VIP relaxes the smooth muscle of the respiratory, gastrointestinal and reproductive tracts, stimulates exocrine and endocrine secretion, increases the survival time of neurons, and promotes the proliferation of untransformed and cancer cells.
Sequence One-Letter Code	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535045982

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-22872-safety-datasheet.pdf