« Back
Home /
VIP, human, porcine, rat - 0.5 mg

VIP, human, porcine, rat - 0.5 mg

Item no.	AS-22872
Manufacturer	AnaSpec
Amount	0.5 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
Citations	Paul, S. et al. J Biol Chem 276, 28314 (2001)Paul, S. et al. J Biol Chem 266,16128 (1991)Delgado, M. et al. J. Leukocyte Biol 73, 155 (2003)Yamamoto, K. et al. Diabetes 52, 1155 (2003)Ganea, D. Cell Mol Biol (Noisy-le-grand) 49, 127 (2003)Poso, D. and M. Delgado, FASEB J 18, 1325 (2004)Romano, D. et al. J Biol Chem 278, 51386 (2003).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3326
Description	28-amino acid neuropeptide VIP (Vasoactive Intestinal Peptide) is a neurotransmitter and a neuromodulator. VIP is broadly distributed in the peripheral and central nervous systems. It has an amino acid sequence identity of 68% with pituitary adenylate cyclase-activating polypeptide (PACAP). VIP and PACAP inhibit TNF-a, IL-1ÃŸ, IL-6, and NO production by lipopolysaccharide (LPS)-activated microglia. Both regulate the production of proinflammatory factors at a transcriptional level by inhibiting p65 nuclear translocation and nuclear factor-kB-DNA binding. As well, VIP relaxes the smooth muscle of the respiratory, gastrointestinal and reproductive tracts, stimulates exocrine and endocrine secretion, increases the survival time of neurons, and promotes the proliferation of untransformed and cancer cells.
Product Group	LB1A1Z
Research Area	Cardiovascular Research; Hormones; Cell Signaling / Lyophilized
Sequence One-Letter Code	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
GTIN	5400535045982
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-22872-safety-datasheet.pdf