« Zurück
Startseite /
[Gly22]-β-Amyloid (1-42), Arctic Mutation - 0.5 mg

[Gly22]-β-Amyloid (1-42), Arctic Mutation - 0.5 mg

ArtNr	AS-61967-05
Hersteller	AnaSpec
Menge	0.5 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Citations	Yamamoto, N. et al. J. Biol. Chem. 282, 2646 (2007), Van Nostrand, W. et al. J. Biol. Chem. 276, 32860 (2001).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	beta-amyloid; beta-amyloid (1-42)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4442.4
Description	This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in "Arctic" heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Product Group	LB1A3Z
Research Area	Neuroscience / Lyophilized
Sequence One-Letter Code	DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
GTIN	5400535150327
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-61967-05-safety-datasheet.pdf