« Back
Home /
[Gly22]-β-Amyloid (1-42), Arctic Mutation - 0.5 mg

[Gly22]-β-Amyloid (1-42), Arctic Mutation - 0.5 mg

Item no.	AS-61967-05
Manufacturer	AnaSpec
Amount	0.5 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Citations	Yamamoto, N. et al. J. Biol. Chem. 282, 2646 (2007), Van Nostrand, W. et al. J. Biol. Chem. 276, 32860 (2001).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	beta-amyloid; beta-amyloid (1-42)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4442.4
Description	This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in "Arctic" heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Product Group	LB1A3Z
Research Area	Neuroscience / Lyophilized
Sequence One-Letter Code	DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
GTIN	5400535150327
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-61967-05-safety-datasheet.pdf