« Zurück
Startseite /
[Gln22,Asn23]-beta-Amyloid (1-40), Dutch/Iowa double mutation

[Gln22,Asn23]-beta-Amyloid (1-40), Dutch/Iowa double mutation

ArtNr	AS-62146
Hersteller	AnaSpec
CAS-Nr.	374796-75-5
Menge	0.5 mg
Kategorie	Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Citations	Van Nostrand, W. et al. Ann. N.Y. Acad. Sci. 977, 258 (2002).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	beta-amyloid, beta-amyloid (1-40)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4328.2
Manufacturer - Research Area	Neuroscience / Alzheimer's Disease
Description	Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. The Dutch/Iowa mutant beta-amyloid rapidly assembles in solution to form fibrils. This double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant forms in causing pathologic responses in culture cells. The double mutation further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.
Sequence One-Letter Code	DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535149758

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-62146-safety-datasheet.pdf