« Zurück
Startseite /
Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP) - 1 mg

Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP) - 1 mg

ArtNr	AS-64606
Hersteller	AnaSpec
Menge	1 mg
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience By Cell Type Carcinoma Peptides & Proteins Peptides
Typ	Peptides
Format	Lyophilized
Specific against	other
Konjugat/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Lys-Ser-Lys-Lys-Ala-Val-Trp-His-Lys-Leu-Leu-Ser-Lys-Gln-Arg-Arg-Arg-Ala-Val-Val-Ala-Cys-Phe-Arg-Met-Thr-Pro-Leu-Tyr-Asn-OH
Citations	Kovaks, E. et al. J Biol Chem 285, 1799 (2010).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Ryanodine Receptor (RYR)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3616.6
Description	This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Product Group	LB1A1Z
Research Area	Cell Signaling / Lyophilized
Sequence One-Letter Code	KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
GTIN	5400535143657
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-64606-safety-datasheet.pdf