« Back
Home /
Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP) - 1 mg

Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP) - 1 mg

Item no.	AS-64606
Manufacturer	AnaSpec
Amount	1 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience By Cell Type Carcinoma Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Lys-Ser-Lys-Lys-Ala-Val-Trp-His-Lys-Leu-Leu-Ser-Lys-Gln-Arg-Arg-Arg-Ala-Val-Val-Ala-Cys-Phe-Arg-Met-Thr-Pro-Leu-Tyr-Asn-OH
Citations	Kovaks, E. et al. J Biol Chem 285, 1799 (2010).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Ryanodine Receptor (RYR)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3616.6
Description	This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Product Group	LB1A1Z
Research Area	Cell Signaling / Lyophilized
Sequence One-Letter Code	KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
GTIN	5400535143657
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-64606-safety-datasheet.pdf