« Zurück
Startseite /
Cardiac Ryanodine Receptor RYR2 (2460-2495) - 1 mg

Cardiac Ryanodine Receptor RYR2 (2460-2495) - 1 mg

ArtNr	AS-64769
Hersteller	AnaSpec
Menge	1 mg
Kategorie	Oncology Peptides & Proteins Peptides By Organ Colorectal Cancer
Typ	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-Gly-Phe-Cys-Pro-Asp-His-Lys-Ala-Ala-Met-Val-Leu-Phe-Leu-Asp-Arg-Val-Tyr-Gly-Ile-Glu-Val-Gln-Asp-Phe-Leu-Leu-His-Leu-Leu-Glu-Val-Gly-Phe-Leu-Pro-OH
Citations	Jiang, D. et al. Proc Natl Acad Sci U S A 101, 35 (2004).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Ryanodine Receptor (RYR)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4104.1
Description	This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death.
Product Group	LB1A1Z
Research Area	Cardiovascular Research / Lyophilized
Sequence One-Letter Code	GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
GTIN	5400535142711
Usage	Research use
UNSPSC	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

AS-64769-safety-datasheet.pdf