« Back
Home /
Cardiac Ryanodine Receptor RYR2 (2460-2495) - 1 mg

Cardiac Ryanodine Receptor RYR2 (2460-2495) - 1 mg

Item no.	AS-64769
Manufacturer	AnaSpec
Amount	1 mg
Category	Oncology Peptides & Proteins Peptides By Organ Colorectal Cancer
Type	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-Gly-Phe-Cys-Pro-Asp-His-Lys-Ala-Ala-Met-Val-Leu-Phe-Leu-Asp-Arg-Val-Tyr-Gly-Ile-Glu-Val-Gln-Asp-Phe-Leu-Leu-His-Leu-Leu-Glu-Val-Gly-Phe-Leu-Pro-OH
Citations	Jiang, D. et al. Proc Natl Acad Sci U S A 101, 35 (2004).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Ryanodine Receptor (RYR)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4104.1
Description	This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death.
Product Group	LB1A1Z
Research Area	Cardiovascular Research / Lyophilized
Sequence One-Letter Code	GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
GTIN	5400535142711
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-64769-safety-datasheet.pdf