Vergleich

Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant, His Tag

Hersteller Angio-Proteomie
Kategorie
Typ Proteins Recombinant
Specific against other
Menge 10ug
ArtNr ANG-rAP-2084-10ug
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Description
Product Name: Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant, His Tag
Synonyms: Ubiquitin-conjugating enzyme E2 L3, EC 6.3.2.19, Ubiquitin-protein ligase L3, Ubiquitin carrier protein L3, UbcH7, E2-F1, L-UBC, UbcM4.
Description: Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant produced in E.coli is an 18.9 kDa protein containing 162 amino acids.The UBE2L3 protein contains 6xHis tag and is purified by proprietary chromatographic techniques.
Uniprot Accesion Number: P68036
Amino Acid Sequence:MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD.
Source: Escherichia Coli.
Physical Appearance and Stability: Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution UBE2L3 should be stored at 4C between 2-7 days and for future use below -18C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation and Purity: Lyophilized from a 0.2um filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5. Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Application:
Solubility: It is recommended to reconstitute the lyophilized UBE2L3 in sterile water not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity:
Shipping Format and Condition: Lyophilized powder at room temperature.
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen