Macrophage Migration Inhibitory Factor Human Recombinant, His Tag C-Terminus

Lyophilized powder at room temperature.

MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chaincontaining 123 amino acidsand having a molecular mass of 13.5 kDa.
Amino Acid Sequence:MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH.
Physical Appearance and Stability: Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution MIF should be stored at 4C between 2-7 days and for future use below -18C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation and Purity: Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4. Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Solubility: It is recommended to reconstitute the lyophilized MIF in sterile 18MO-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity: Measured by its ability to bind rhCD74 in a functional ELISA.